PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA39399
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family CPP
Protein Properties Length: 583aa    MW: 65584.3 Da    PI: 5.3087
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA39399genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR45.41.6e-14465504241
                        TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                                + ++C+C+ks+Clk YCeCfa g+ C   C+C+dC+N+++
  Tp57577_TGAC_v2_mRNA39399 465 KYRSCRCRKSRCLKDYCECFAFGVSCIGLCQCQDCMNNKS 504
                                5689*********************************985 PP

2TCR24.36.2e-08512551241
                        TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                                 +k+C+C  s+ l   CeCf+ag++C+ +C+C++C N+ +
  Tp57577_TGAC_v2_mRNA39399 512 ACKQCRCITSNYLIPNCECFSAGVYCTGHCSCKHCLNNGD 551
                                589**********************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011142.2E-8464505IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163415.674465551IPR005172CRC domain
PfamPF036382.0E-10467502IPR005172CRC domain
SMARTSM011140.002511552IPR033467Tesmin/TSO1-like CXC domain
PfamPF036388.9E-5514549IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 583 aa     Download sequence    Send to blast
MEAPPFSNSE EDESLFEYLN SLSPLKTKKR VEATQTLNSL GMDYSLLASP DATIYEESTV  60
LMRHLNYILN TSEPQVSSEE ALTDPAHACH YSLESSSQHT KIELPQAMQY NPCSSEQRPL  120
ISTEEAKWAL ELLGKQVPNG TDVQDDYMED SVEGGTYIRE VGQVEANIEG ADCDYNNLIS  180
ITQFVNLLPQ STTNSNYKMQ TVEPVASSSY PSEPIAATDR NQTWNNLANV ALRDSNPIAR  240
GVDELACIMR PYQSYQPEMS SLQRNNYVYT SKSDEMNAII KENPLLPRKN TSDLQMCVLP  300
RNDFYLNVHP ALNNYKAIEN EKMSSRRKPE SPSCTSSLHF SASQVHHLSP VPAPTERHLE  360
PSENDDFTKS SVHIPGKDFC RSCNPDLMSR VQFNELTNKL FDQNMKKTSK VKSKDLIGLV  420
SSGSEHEMEG ESADVCQNYA TGKRKTNTNV RLYRKWSDLT GKGRKYRSCR CRKSRCLKDY  480
CECFAFGVSC IGLCQCQDCM NNKSDLTGEE EACKQCRCIT SNYLIPNCEC FSAGVYCTGH  540
CSCKHCLNNG DNEDTILQAR QKNDPKVVRS SDSSPQIFYF WI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013469790.11e-155tesmin/TSO1-like CXC domain protein
TrEMBLA0A072VQY21e-155A0A072VQY2_MEDTR; Tesmin/TSO1-like CXC domain protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2056123
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22780.13e-13Tesmin/TSO1-like CXC domain-containing protein